![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
![]() | Protein automated matches [190056] (133 species) not a true protein |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [188853] (4 PDB entries) |
![]() | Domain d3hjpc_: 3hjp C: [177617] automated match to d2cx3a1 complexed with cl |
PDB Entry: 3hjp (more details), 2.55 Å
SCOPe Domain Sequences for d3hjpc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hjpc_ c.47.1.0 (C:) automated matches {Sulfolobus solfataricus [TaxId: 2287]} mveigekapeielvdtdlkkvkipsdfkgkvvvlafypaaftsvstkemstfrdsmakfn evnavvigisvdppfsnkafkeqnkinftivsdfnreavkaygvagelpilkgyvlakrs vfvidkngivrykwvsedptkepnydeikdvvtklsle
Timeline for d3hjpc_: