SCOPe 2.07: Domain d3hhhb_: 3hhh B:

Lineage for d3hhhb_ (3hhh B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (87 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:1351] [188913] (1 PDB entry)

8. Domain d3hhhb_: 3hhh B: [177575]
   automated match to d1xmab_
   complexed with gol, so4

Details for d3hhhb_

PDB Entry: 3hhh, 2.7 Å

PDB Description: Crystal structure of transcriptional regulator, a member of PadR family, from Enterococcus faecalis V583

PDB Compounds: (B:) Transcriptional regulator, PadR family

SCOPe Domain Sequences for d3hhhb_:

Sequence; same for both SEQRES and ATOM records:

>d3hhhb_ a.4.5.0 (B:) automated matches {Enterococcus faecalis [TaxId: 1351]}
kqtellkgileglvlaiiqrketygyeitkilndqgfteivegtvytillrleknqwvia
ekkpsekgpmrkfyrltssgeaeladfwqrwtllskqvnkmkk

Timeline for d3hhhb_:

• d3hhhb_ first appeared in SCOPe 2.01
  
• d3hhhb_ appears in SCOPe 2.06
  
• d3hhhb_ appears in the current release, SCOPe 2.08