Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Myoglobin [46469] (9 species) |
Species Horse (Equus caballus) [TaxId:9796] [46474] (62 PDB entries) |
Domain d3heoa_: 3heo A: [177454] automated match to d1bjea_ complexed with hem, no2; mutant |
PDB Entry: 3heo (more details), 2 Å
SCOPe Domain Sequences for d3heoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3heoa_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]} glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased lkkvgtrvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp gdfgadaqgamtkalelfrndiaakykelgfqg
Timeline for d3heoa_: