Lineage for d3heic_ (3hei C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2384653Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2384654Protein automated matches [190770] (49 species)
    not a true protein
  7. 2384921Species Human (Homo sapiens) [TaxId:9606] [188939] (29 PDB entries)
  8. 2384952Domain d3heic_: 3hei C: [177432]
    Other proteins in same PDB: d3heib1, d3heib2, d3heid1, d3heid2, d3heif1, d3heif2, d3heih1, d3heih2, d3heij1, d3heij2, d3heil1, d3heil2, d3hein1, d3hein2, d3heip1, d3heip2
    automated match to d1kgya_

Details for d3heic_

PDB Entry: 3hei (more details), 2 Å

PDB Description: ligand recognition by a-class eph receptors: crystal structures of the epha2 ligand-binding domain and the epha2/ephrin-a1 complex
PDB Compounds: (C:) Ephrin type-A receptor 2

SCOPe Domain Sequences for d3heic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3heic_ b.18.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evvlldfaaaggelgwlthpygkgwdlmqnimndmpiymysvcnvmsgdqdnwlrtnwvy
rgeaerifielkftvrdcnsfpggasscketfnlyyaesdldygtnfqkrlftkidtiap
deitvssdfearhvklnveersvgpltrkgfylafqdigacvallsvrvyykkc

SCOPe Domain Coordinates for d3heic_:

Click to download the PDB-style file with coordinates for d3heic_.
(The format of our PDB-style files is described here.)

Timeline for d3heic_: