Lineage for d1gsq_1 (1gsq 76-202)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily) Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) 
Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins) 
Protein Glutathione S-transferase [47618] (27 species) 
Species Squid (Ommastrephes sloani pacificus), class sigma [47631] (2 PDB entries) 
Domain d1gsq_1: 1gsq 76-202 [17716]
Other proteins in same PDB: d1gsq_2
Details for d1gsq_1
PDB Entry: 1gsq (more details), 2.4 Å
PDB Description: three-dimensional structure, catalytic properties and evolution of a sigma class glutathione transferase from squid, a progenitor of the lens-crystallins of cephalopods
SCOP Domain Sequences for d1gsq_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gsq_1 a.45.1.1 (76-202) Glutathione S-transferase {Squid (Ommastrephes sloani pacificus), class sigma}
ldgktslekyrvdeitetlqdifndvvkikfapeaakeavqqnyeksckrlapflegllv
sngggdgffvgnsmtladlhcyvalevplkhtpellkdcpkivalrkrvaecpkiaaylk
krpvrdf
SCOP Domain Coordinates for d1gsq_1:
Click to download the PDB-style file with coordinates for d1gsq_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gsq_1:
- d1gsq_1 first appeared (with stable ids) in SCOP 1.55
- d1gsq_1 appears in SCOP 1.59
- d1gsq_1 appears in SCOP 1.63
- d1gsq_1 appears in the current release, SCOPe 2.08, called d1gsqa1
View in 3D
