SCOPe 2.07: Domain d3gzxb_: 3gzx B:

Lineage for d3gzxb_ (3gzx B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
   Pfam PF00866

6. Protein automated matches [190223] (5 species)
   not a true protein

7. Species Comamonas testosteroni [TaxId:285] [189310] (2 PDB entries)

8. Domain d3gzxb_: 3gzx B: [177118]
   Other proteins in same PDB: d3gzxa1, d3gzxa2
   automated match to d1wqlb1
   complexed with bnl, fe2, fes, gol, mes

Details for d3gzxb_

PDB Entry: 3gzx, 1.58 Å

PDB Description: crystal structure of the biphenyl dioxygenase in complex with biphenyl from comamonas testosteroni sp. strain b-356

PDB Compounds: (B:) Biphenyl dioxygenase subunit beta

SCOPe Domain Sequences for d3gzxb_:

Sequence; same for both SEQRES and ATOM records:

>d3gzxb_ d.17.4.4 (B:) automated matches {Comamonas testosteroni [TaxId: 285]}
mistplskefewpakpvslelqhqveqfyyreaqlldhhafqawfallaedihywmpirt
vrtareqgleyvpaganahfddthatmygrirqktsdlnwaedppsrtrhlvsnvivrem
dtpgtlevasafllyrsrlerqvdvfagerrdvlriadnplgfqiakrtiildqstvlan
nlsvff

Timeline for d3gzxb_:

• d3gzxb_ first appeared in SCOPe 2.01
  
• d3gzxb_ appears in SCOPe 2.06
  
• d3gzxb_ appears in the current release, SCOPe 2.08