![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein automated matches [190091] (20 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188447] (892 PDB entries) |
![]() | Domain d3guba1: 3gub A:2-277 [177006] Other proteins in same PDB: d3guba2 automated match to d1ig1a_ complexed with gub, so4 |
PDB Entry: 3gub (more details), 1.71 Å
SCOPe Domain Sequences for d3guba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3guba1 d.144.1.7 (A:2-277) automated matches {Human (Homo sapiens) [TaxId: 9606]} tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi erevsilkeiqhpnvitlhevyenktdviligelvaggelfdflaekeslteeeateflk qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf sntsalakdfirrllvkdpkkrmtiqdslqhpwikp
Timeline for d3guba1: