Lineage for d3guba1 (3gub A:2-277)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2589707Protein automated matches [190091] (20 species)
    not a true protein
  7. 2589831Species Human (Homo sapiens) [TaxId:9606] [188447] (892 PDB entries)
  8. 2590003Domain d3guba1: 3gub A:2-277 [177006]
    Other proteins in same PDB: d3guba2
    automated match to d1ig1a_
    complexed with gub, so4

Details for d3guba1

PDB Entry: 3gub (more details), 1.71 Å

PDB Description: crystal structure of dapkl93g complexed with n6-(2-phenylethyl) adenosine
PDB Compounds: (A:) Death-associated protein kinase 1

SCOPe Domain Sequences for d3guba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3guba1 d.144.1.7 (A:2-277) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
erevsilkeiqhpnvitlhevyenktdviligelvaggelfdflaekeslteeeateflk
qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp
efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf
sntsalakdfirrllvkdpkkrmtiqdslqhpwikp

SCOPe Domain Coordinates for d3guba1:

Click to download the PDB-style file with coordinates for d3guba1.
(The format of our PDB-style files is described here.)

Timeline for d3guba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3guba2