Lineage for d1ev9c1 (1ev9 C:80-208)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1491601Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1491602Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1491603Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1491614Protein Class alpha GST [81349] (8 species)
  7. 1491733Species Norway rat (Rattus norvegicus), (a1-1) [TaxId:10116] [47626] (2 PDB entries)
  8. 1491738Domain d1ev9c1: 1ev9 C:80-208 [17697]
    Other proteins in same PDB: d1ev9a2, d1ev9c2, d1ev9d2
    complexed with gts, so4; mutant

Details for d1ev9c1

PDB Entry: 1ev9 (more details), 2.2 Å

PDB Description: rat glutathione s-transferase a1-1 mutant w21f with gso3 bound
PDB Compounds: (C:) glutathione s-transferase a1-1

SCOPe Domain Sequences for d1ev9c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ev9c1 a.45.1.1 (C:80-208) Class alpha GST {Norway rat (Rattus norvegicus), (a1-1) [TaxId: 10116]}
dlygkdmkeralidmysegildltemimqlvicppdqkeaktalakdrtknrylpafekv
lkshgqdylvgnkltrvdihllelllyveefdaslltsfpllkafksrisslpnvkkflq
pgsqrklpm

SCOPe Domain Coordinates for d1ev9c1:

Click to download the PDB-style file with coordinates for d1ev9c1.
(The format of our PDB-style files is described here.)

Timeline for d1ev9c1: