SCOP 1.71: Domain d1ev4a1: 1ev4 A:80-222

Lineage for d1ev4a1 (1ev4 A:80-222)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Rat (Rattus norvegicus), (a1-1) [TaxId:10116] [47626] (2 PDB entries)

8. Domain d1ev4a1: 1ev4 A:80-222 [17693]
   Other proteins in same PDB: d1ev4a2, d1ev4c2, d1ev4d2

Details for d1ev4a1

PDB Entry: 1ev4, 2.2 Å

PDB Description: rat glutathione s-transferase a1-1: mutant w21f/f220y with gso3 bound

SCOP Domain Sequences for d1ev4a1:

Sequence; same for both SEQRES and ATOM records:

>d1ev4a1 a.45.1.1 (A:80-222) Class alpha GST {Rat (Rattus norvegicus), (a1-1)}
dlygkdmkeralidmysegildltemimqlvicppdqkeaktalakdrtknrylpafekv
lkshgqdylvgnkltrvdihllelllyveefdaslltsfpllkafksrisslpnvkkflq
pgsqrklpmdakqieearkiykf

Timeline for d1ev4a1:

• d1ev4a1 first appeared (with stable ids) in SCOP 1.55
  
• d1ev4a1 appears in SCOP 1.69
  
• d1ev4a1 appears in SCOP 1.73
  
• d1ev4a1 appears in the current release, SCOPe 2.08