Lineage for d3gqfd_ (3gqf D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2373677Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2373678Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2373698Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 2373801Species Human (Homo sapiens) [TaxId:9606] [49333] (95 PDB entries)
  8. 2374003Domain d3gqfd_: 3gqf D: [176906]
    automated match to d1oezw_
    complexed with ca, zn

Details for d3gqfd_

PDB Entry: 3gqf (more details), 2.2 Å

PDB Description: structural and biophysical properties of the pathogenic sod1 variant h46r/h48q
PDB Compounds: (D:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d3gqfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gqfd_ b.1.8.1 (D:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfrvqefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

SCOPe Domain Coordinates for d3gqfd_:

Click to download the PDB-style file with coordinates for d3gqfd_.
(The format of our PDB-style files is described here.)

Timeline for d3gqfd_: