Lineage for d3gj7a_ (3gj7 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1594390Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1595107Protein Ran [52609] (2 species)
  7. 1595127Species Human (Homo sapiens) [TaxId:9606] [52611] (29 PDB entries)
  8. 1595142Domain d3gj7a_: 3gj7 A: [176694]
    Other proteins in same PDB: d3gj7b_, d3gj7d_
    automated match to d1byub_
    protein/DNA complex; protein/RNA complex; complexed with gdp, mg, zn

Details for d3gj7a_

PDB Entry: 3gj7 (more details), 1.93 Å

PDB Description: crystal structure of human rangdp-nup153znf12 complex
PDB Compounds: (A:) GTP-binding nuclear protein ran

SCOPe Domain Sequences for d3gj7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gj7a_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}
pqvqfklvlvgdggtgkttfvkrhltgesekkyvatlgvevhplvfhtnrgpikfnvwdt
agqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdi
kdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappe
vvmdpalaaqyehdlevaqtt

SCOPe Domain Coordinates for d3gj7a_:

Click to download the PDB-style file with coordinates for d3gj7a_.
(The format of our PDB-style files is described here.)

Timeline for d3gj7a_: