Lineage for d6gswb1 (6gsw B:85-217)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 443394Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 443395Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 443396Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 443530Protein Class mu GST [81348] (3 species)
  7. 443564Species Rat (Rattus norvegicus) [TaxId:10116] [47623] (16 PDB entries)
  8. 443568Domain d6gswb1: 6gsw B:85-217 [17632]
    Other proteins in same PDB: d6gswa2, d6gswb2

Details for d6gswb1

PDB Entry: 6gsw (more details), 1.85 Å

PDB Description: first-sphere and second-sphere electrostatic effects in the active site of a class mu glutathione transferase

SCOP Domain Sequences for d6gswb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gswb1 a.45.1.1 (B:85-217) Class mu GST {Rat (Rattus norvegicus)}
lcgeteeeriradivenqvmdnrmqlimlcynpdfekqkpeflktipekmklyseflgkr
pwfagdkvtyvdflaydildqyhifepkcldafpnlkdflarfeglkkisaymkssryls
tpifsklaqwsnk

SCOP Domain Coordinates for d6gswb1:

Click to download the PDB-style file with coordinates for d6gswb1.
(The format of our PDB-style files is described here.)

Timeline for d6gswb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6gswb2