Class a: All alpha proteins [46456] (285 folds) |
Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.7: BAG domain [63491] (1 family) |
Family a.7.7.1: BAG domain [63492] (4 proteins) Pfam PF02179 this is a repeat family; one repeat unit is 1hx1 B:151-261 found in domain |
Protein BAG-family molecular chaperon regulator-1, BAG1 [63493] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [63494] (8 PDB entries) |
Domain d3fzkb_: 3fzk B: [176212] Other proteins in same PDB: d3fzka1, d3fzka2 automated match to d1hx1b_ complexed with 3bk, cl, trs |
PDB Entry: 3fzk (more details), 2.1 Å
SCOPe Domain Sequences for d3fzkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fzkb_ a.7.7.1 (B:) BAG-family molecular chaperon regulator-1, BAG1 {Human (Homo sapiens) [TaxId: 9606]} gnspqeevelkklkhleksvekiadqleelnkeltgiqqgflpkdlqaealckldrrvka tieqfmkileeidtlilpenfkdsrlkrkglvkkvqaflaecdtveqnicq
Timeline for d3fzkb_: