Lineage for d3fzkb_ (3fzk B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1481355Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1481594Superfamily a.7.7: BAG domain [63491] (1 family) (S)
  5. 1481595Family a.7.7.1: BAG domain [63492] (4 proteins)
    Pfam PF02179
    this is a repeat family; one repeat unit is 1hx1 B:151-261 found in domain
  6. 1481596Protein BAG-family molecular chaperon regulator-1, BAG1 [63493] (3 species)
  7. 1481597Species Human (Homo sapiens) [TaxId:9606] [63494] (8 PDB entries)
  8. 1481602Domain d3fzkb_: 3fzk B: [176212]
    Other proteins in same PDB: d3fzka1, d3fzka2
    automated match to d1hx1b_
    complexed with 3bk, cl, trs

Details for d3fzkb_

PDB Entry: 3fzk (more details), 2.1 Å

PDB Description: Crystal Structures of Hsc70/Bag1 in Complex with Small Molecule Inhibitors
PDB Compounds: (B:) BAG family molecular chaperone regulator 1

SCOPe Domain Sequences for d3fzkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fzkb_ a.7.7.1 (B:) BAG-family molecular chaperon regulator-1, BAG1 {Human (Homo sapiens) [TaxId: 9606]}
gnspqeevelkklkhleksvekiadqleelnkeltgiqqgflpkdlqaealckldrrvka
tieqfmkileeidtlilpenfkdsrlkrkglvkkvqaflaecdtveqnicq

SCOPe Domain Coordinates for d3fzkb_:

Click to download the PDB-style file with coordinates for d3fzkb_.
(The format of our PDB-style files is described here.)

Timeline for d3fzkb_: