Lineage for d1gtud1 (1gtu D:85-217)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1491601Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1491602Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1491603Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1491803Protein Class mu GST [81348] (3 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [47622] (15 PDB entries)
    Uniprot P09488 P28161
  8. 1491836Domain d1gtud1: 1gtu D:85-217 [17610]
    Other proteins in same PDB: d1gtua2, d1gtub2, d1gtuc2, d1gtud2

Details for d1gtud1

PDB Entry: 1gtu (more details), 2.68 Å

PDB Description: ligand-free human glutathione s-transferase m1a-1a
PDB Compounds: (D:) glutathione s-transferase

SCOPe Domain Sequences for d1gtud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtud1 a.45.1.1 (D:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgeteeekirvdilenqtmdnhmqlgmicynpefeklkpkyleelpeklklyseflgkr
pwfagnkitfvdflvydvldlhrifepkcldafpnlkdfisrfeglekisaymkssrflp
rpvfskmavwgnk

SCOPe Domain Coordinates for d1gtud1:

Click to download the PDB-style file with coordinates for d1gtud1.
(The format of our PDB-style files is described here.)

Timeline for d1gtud1: