![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins) formerly omega-Aminoacid:pyruvate aminotransferase-like |
![]() | Protein automated matches [190152] (25 species) not a true protein |
![]() | Species Synechococcus elongatus [TaxId:269084] [187818] (8 PDB entries) |
![]() | Domain d3fq8a_: 3fq8 A: [175969] automated match to d2gsaa_ complexed with pmp; mutant |
PDB Entry: 3fq8 (more details), 2 Å
SCOPe Domain Sequences for d3fq8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fq8a_ c.67.1.4 (A:) automated matches {Synechococcus elongatus [TaxId: 269084]} fktiksdeifaaaqklmpggvsspvrafksvggqpivfdrvkdayawdvdgnryidyvgt wgpaicghahpeviealkvamekgtsfgapcalenvlaemvndavpsiemvrfvnsgtea cmavlrimraytgrdkiikfegcyhghadmflvkagsgvatlglpsspgvpkkttantlt tpyndleavkalfaenpgeiagvilepivgnsgfivpdagfleglreitlehdallvfde vitgfriayggvqekfgvtpdlttlgkiiggglpvgayggkreimqlvapagpmyqagtl sgnplamtagiktlellrqpgtyeyldqitkrlsdgllaiaqetghaacggqvsgmfgff ftegpvhnyedakksdlqkfsrfhrgmleqgiylapsqfeagftslahteedidatlaaa rtvmsal
Timeline for d3fq8a_: