![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
![]() | Protein Class pi GST [81347] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47619] (66 PDB entries) |
![]() | Domain d4gssa1: 4gss A:77-209 [17570] Other proteins in same PDB: d4gssa2, d4gssb2 complexed with gtx, mes; mutant |
PDB Entry: 4gss (more details), 2.5 Å
SCOPe Domain Sequences for d4gssa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gssa1 a.45.1.1 (A:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} glygkdqqeaalvdmvndgvedlrckyisliftnyeagkddyvkalpgqlkpfetllsqn qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp eyvnlpingngkq
Timeline for d4gssa1: