Lineage for d3f71a_ (3f71 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2467009Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2467192Family c.23.16.2: DJ-1/PfpI [52325] (10 proteins)
    contains a catalytic triad or dyad different from the class I GAT triad
  6. 2467350Protein automated matches [190995] (9 species)
    not a true protein
  7. 2467361Species Human (Homo sapiens) [TaxId:9606] [188709] (1 PDB entry)
  8. 2467362Domain d3f71a_: 3f71 A: [175528]
    automated match to d1pdwg_

Details for d3f71a_

PDB Entry: 3f71 (more details), 1.2 Å

PDB Description: crystal structure of e18d dj-1 with oxidized c106
PDB Compounds: (A:) Protein DJ-1

SCOPe Domain Sequences for d3f71a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f71a_ c.23.16.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
askralvilakgaeemdtvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasleda
kkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheigfgs
kvtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaqv
kaplvlk

SCOPe Domain Coordinates for d3f71a_:

Click to download the PDB-style file with coordinates for d3f71a_.
(The format of our PDB-style files is described here.)

Timeline for d3f71a_: