SCOPe 2.03: Domain d3f4ca_: 3f4c A:

Lineage for d3f4ca_ (3f4c A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.0: automated matches [191327] (1 protein)
   not a true family

6. Protein automated matches [190150] (16 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:272567] [188974] (2 PDB entries)

8. Domain d3f4ca_: 3f4c A: [175456]
   automated match to d2d2ga1
   complexed with co, gol

Details for d3f4ca_

PDB Entry: 3f4c, 2.07 Å

PDB Description: Crystal structure of organophosphorus hydrolase from Geobacillus stearothermophilus strain 10, with glycerol bound

PDB Compounds: (A:) Organophosphorus hydrolase

SCOPe Domain Sequences for d3f4ca_:

Sequence; same for both SEQRES and ATOM records:

>d3f4ca_ c.1.9.0 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 272567]}
ktvetvlgpvpveqlgktlihehflfgypgfqgdvtrgtfredealrvaveaaekmkrhg
iqtvvdptpndcgrnpaflrrvaeetglniicatgyyyegegappyfqfrrllgtaeddi
ydmfmaeltegiadtgikagviklasskgriteyekmffraaaraqketgaviithtqeg
tmgpeqaayllehgadpkkivighmcgntdpdyhrktlaygvyiafdrfgiqgmvgaptd
eervrtllallrdgyekqimlshdtvnvwlgrpftlpepfaemmknwhvehlfvniipal
knegirdevleqmfignpaalfsa

Timeline for d3f4ca_:

• d3f4ca_ first appeared in SCOPe 2.01
  
• d3f4ca_ appears in SCOPe 2.02
  
• d3f4ca_ appears in SCOPe 2.04
  
• d3f4ca_ appears in the current release, SCOPe 2.08, called d3f4ca1