Lineage for d22gsa1 (22gs A:77-209)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1270513Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1270514Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1270515Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1270840Protein Class pi GST [81347] (4 species)
  7. 1270841Species Human (Homo sapiens) [TaxId:9606] [47619] (52 PDB entries)
  8. 1270884Domain d22gsa1: 22gs A:77-209 [17542]
    Other proteins in same PDB: d22gsa2, d22gsb2
    complexed with mes; mutant

Details for d22gsa1

PDB Entry: 22gs (more details), 1.9 Å

PDB Description: human glutathione s-transferase p1-1 y49f mutant
PDB Compounds: (A:) glutathione s-transferase p1-1

SCOPe Domain Sequences for d22gsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d22gsa1 a.45.1.1 (A:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOPe Domain Coordinates for d22gsa1:

Click to download the PDB-style file with coordinates for d22gsa1.
(The format of our PDB-style files is described here.)

Timeline for d22gsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d22gsa2