Lineage for d3emva1 (3emv A:1-245)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2495644Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2495645Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2496449Protein automated matches [190142] (20 species)
    not a true protein
  7. 2496563Species Plasmodium vivax [TaxId:5855] [188970] (1 PDB entry)
  8. 2496564Domain d3emva1: 3emv A:1-245 [175092]
    Other proteins in same PDB: d3emva2
    automated match to d1nw4a_
    complexed with so4

Details for d3emva1

PDB Entry: 3emv (more details), 1.85 Å

PDB Description: Crystal structure of Plasmodium vivax PNP with sulphate
PDB Compounds: (A:) Uridine phosphorylase, putative

SCOPe Domain Sequences for d3emva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3emva1 c.56.2.1 (A:1-245) automated matches {Plasmodium vivax [TaxId: 5855]}
megemqrhikltkaqttpvvlvvgdpgrvdkvkvlcdsyvdlaynreyksvectykgqkf
lcvshgvgsagcaicfeelmnngakviiragscgslqptqmkrgdicicnaavredrvsh
lmiysdfpavadyevyatlnqvaeelkvpvfngislssdmyyphkiiptrledyskanva
vvemevatlmvmgtlrkvktggifivdgcplkwdegdfdnnlvperlenmikisletcar
lakky

SCOPe Domain Coordinates for d3emva1:

Click to download the PDB-style file with coordinates for d3emva1.
(The format of our PDB-style files is described here.)

Timeline for d3emva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3emva2