Class b: All beta proteins [48724] (178 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein Human immunodeficiency virus type 1 protease [50632] (9 species) |
Species Hiv-1 m:b_arv2/sf2 [TaxId:11685] [187932] (17 PDB entries) |
Domain d3ekva_: 3ekv A: [175033] automated match to d1kzka_ complexed with 478, act |
PDB Entry: 3ekv (more details), 1.75 Å
SCOPe Domain Sequences for d3ekva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ekva_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Hiv-1 m:b_arv2/sf2 [TaxId: 11685]} pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd qipieicghkaigtvlvgptpvniigrnlltqigctlnf
Timeline for d3ekva_: