![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) ![]() |
![]() | Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
![]() | Protein automated matches [190032] (18 species) not a true protein |
![]() | Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (23 PDB entries) |
![]() | Domain d3eicb1: 3eic B:2-130 [174945] Other proteins in same PDB: d3eica2, d3eicb2, d3eicc2, d3eicd2, d3eice2, d3eicf2 automated match to d2b8pa1 complexed with mg, udp |
PDB Entry: 3eic (more details), 2.3 Å
SCOPe Domain Sequences for d3eicb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3eicb1 d.58.6.1 (B:2-130) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]} qrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfnd ncdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdsedsav deisiwfpe
Timeline for d3eicb1: