Lineage for d3ef4c_ (3ef4 C:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1302646Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1302647Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1303941Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 1303942Protein automated matches [190824] (8 species)
    not a true protein
  7. 1303991Species Hyphomicrobium denitrificans [TaxId:53399] [188702] (1 PDB entry)
  8. 1303994Domain d3ef4c_: 3ef4 C: [174909]
    automated match to d1adwa_
    complexed with cu, po4

Details for d3ef4c_

PDB Entry: 3ef4 (more details), 1.18 Å

PDB Description: Crystal structure of native pseudoazurin from Hyphomicrobium denitrificans
PDB Compounds: (C:) Blue copper protein

SCOPe Domain Sequences for d3ef4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ef4c_ b.6.1.0 (C:) automated matches {Hyphomicrobium denitrificans [TaxId: 53399]}
aehivemrnkddagntmvfqpgfvkveagdtvkfvptdkshnaesvrevwpegvapvkgg
fskevvfnaekeglyvlkcaphygmgmvvlvqvgkpvnldqikeykatglakkrldgeia
kvvq

SCOPe Domain Coordinates for d3ef4c_:

Click to download the PDB-style file with coordinates for d3ef4c_.
(The format of our PDB-style files is described here.)

Timeline for d3ef4c_: