Lineage for d1mjqb_ (1mjq B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 355873Fold a.43: Ribbon-helix-helix [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 355874Superfamily a.43.1: Ribbon-helix-helix [47598] (4 families) (S)
    formerly Met repressor-like; dimeric proteins; the N-termini form a small beta-sheet ribbon
  5. 355949Family a.43.1.5: Met repressor, MetJ (MetR) [100972] (1 protein)
  6. 355950Protein Met repressor, MetJ (MetR) [47607] (1 species)
  7. 355951Species Escherichia coli [TaxId:562] [47608] (10 PDB entries)
  8. 355971Domain d1mjqb_: 1mjq B: [17479]

Details for d1mjqb_

PDB Entry: 1mjq (more details), 2.4 Å

PDB Description: methionine repressor mutant (q44k) plus corepressor (s-adenosyl methionine) complexed to an altered met consensus operator sequence

SCOP Domain Sequences for d1mjqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mjqb_ a.43.1.5 (B:) Met repressor, MetJ (MetR) {Escherichia coli}
aewsgeyispyaehgkkseqvkkitvsiplkvlkiltdertrrkvnnlrhatnsellcea
flhaftgqplpddadlrkersdeipeaakeimremginpetwey

SCOP Domain Coordinates for d1mjqb_:

Click to download the PDB-style file with coordinates for d1mjqb_.
(The format of our PDB-style files is described here.)

Timeline for d1mjqb_: