Lineage for d3e8qc_ (3e8q C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2481831Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2481832Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2481833Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
    Pfam PF00491
  6. 2481854Protein Arginase [52770] (5 species)
  7. 2481997Species Norway rat (Rattus norvegicus) [TaxId:10116] [52771] (34 PDB entries)
    Uniprot P07824
  8. 2482075Domain d3e8qc_: 3e8q C: [174756]
    automated match to d1hqfa_
    complexed with mn

Details for d3e8qc_

PDB Entry: 3e8q (more details), 2.9 Å

PDB Description: x-ray structure of rat arginase i-t135a: the unliganded complex
PDB Compounds: (C:) Arginase-1

SCOPe Domain Sequences for d3e8qc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e8qc_ c.42.1.1 (C:) Arginase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kpieiigapfskgqprggvekgpaalrkaglveklketeynvrdhgdlafvdvpndspfq
ivknprsvgkaneqlaavvaetqkngtisvvlggdhsmaigsisgharvhpdlcviwvda
htdintpltassgnlhgqpvafllkelkgkfpdvpgfswvtpcisakdivyiglrdvdpg
ehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvftpatg
tpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavaltlscfg
tkregnhk

SCOPe Domain Coordinates for d3e8qc_:

Click to download the PDB-style file with coordinates for d3e8qc_.
(The format of our PDB-style files is described here.)

Timeline for d3e8qc_: