SCOPe 2.07: Domain d3e5sb_: 3e5s B:

Lineage for d3e5sb_ (3e5s B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family)

5. Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins)
   barrel, closed; n=5, S=10

6. Protein Staphylococcal nuclease [50201] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50202] (270 PDB entries)
   Uniprot P00644 89-223

8. Domain d3e5sb_: 3e5s B: [174675]
   automated match to d1joka_
   complexed with ca, thp

Details for d3e5sb_

PDB Entry: 3e5s, 2 Å

PDB Description: crystal structure of staphylococcal nuclease variant delta+phs l103k at cryogenic temperature

PDB Compounds: (B:) Thermonuclease

SCOPe Domain Sequences for d3e5sb_:

Sequence; same for both SEQRES and ATOM records:

>d3e5sb_ b.40.1.1 (B:) Staphylococcal nuclease {Staphylococcus aureus [TaxId: 1280]}
lhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmvenakki
evefdkgqrtdkygrglayiyadgkmvneakvrqglakvayvykgnntheqllrkaeaqa
kkeklniws

Timeline for d3e5sb_:

• d3e5sb_ first appeared in SCOPe 2.01
  
• d3e5sb_ appears in SCOPe 2.06
  
• d3e5sb_ appears in the current release, SCOPe 2.08