Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) |
Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [102923] (6 PDB entries) |
Domain d3e4uc_: 3e4u C: [174659] automated match to d1r2ba_ |
PDB Entry: 3e4u (more details), 2.1 Å
SCOPe Domain Sequences for d3e4uc_:
Sequence, based on SEQRES records: (download)
>d3e4uc_ d.42.1.1 (C:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} sciqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdqlk cnlsvinldpeinpegfcilldfmytsrlnlregnimavmatamylqmehvvdtcrkfik as
>d3e4uc_ d.42.1.1 (C:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} sciqftrhasdvllnlnrlrsrdiltdvvivveqfrahktvlmacsglfysiftdqlkcn lsvinldeinpegfcilldfmytsrlnlregnimavmatamylqmehvvdtcrkfikas
Timeline for d3e4uc_: