Lineage for d3e1mf_ (3e1m F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2701406Protein Bacterioferritin (cytochrome b1) [47244] (6 species)
    binds heme between two subunits; 24-mer
  7. 2701570Species Escherichia coli [TaxId:562] [47245] (11 PDB entries)
  8. 2701644Domain d3e1mf_: 3e1m F: [174478]
    automated match to d1bcfa_
    complexed with fe2, hem, so4

Details for d3e1mf_

PDB Entry: 3e1m (more details), 2.7 Å

PDB Description: crystal structure of e. coli bacterioferritin (bfr) obtained after soaking apo-bfr crystals for 2.5 minutes in fe2+ (2.5m fe(ii)-bfr)
PDB Compounds: (F:) bacterioferritin

SCOPe Domain Sequences for d3e1mf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e1mf_ a.25.1.1 (F:) Bacterioferritin (cytochrome b1) {Escherichia coli [TaxId: 562]}
mkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyhesidemkhadryie
rilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvhdyvsrdmm
ieilrdeeghidwleteldliqkmglqnylqaqireeg

SCOPe Domain Coordinates for d3e1mf_:

Click to download the PDB-style file with coordinates for d3e1mf_.
(The format of our PDB-style files is described here.)

Timeline for d3e1mf_: