Class a: All alpha proteins [46456] (289 folds) |
Fold a.148: Arp2/3 complex 21 kDa subunit ARPC3 [69059] (1 superfamily) 5 helices; one helix is surrounded by the others |
Superfamily a.148.1: Arp2/3 complex 21 kDa subunit ARPC3 [69060] (1 family) automatically mapped to Pfam PF04062 |
Family a.148.1.1: Arp2/3 complex 21 kDa subunit ARPC3 [69061] (2 proteins) |
Protein automated matches [190347] (1 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [187174] (12 PDB entries) |
Domain d3dxke_: 3dxk E: [174328] Other proteins in same PDB: d3dxka1, d3dxka2, d3dxkb_, d3dxkc_, d3dxkd1, d3dxkd2, d3dxkf_, d3dxkg_ automated match to d1k8ke_ complexed with n23 |
PDB Entry: 3dxk (more details), 2.7 Å
SCOPe Domain Sequences for d3dxke_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dxke_ a.148.1.1 (E:) automated matches {Cow (Bos taurus) [TaxId: 9913]} payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa nkqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnkslsg
Timeline for d3dxke_: