Lineage for d3dxgb_ (3dxg B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2535185Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2535186Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2535187Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2535659Protein automated matches [190061] (7 species)
    not a true protein
  7. 2535662Species Cow (Bos taurus) [TaxId:9913] [186780] (71 PDB entries)
  8. 2535699Domain d3dxgb_: 3dxg B: [174324]
    automated match to d1a2wa_
    complexed with u5p

Details for d3dxgb_

PDB Entry: 3dxg (more details), 1.39 Å

PDB Description: ribonuclease a- uridine 5' phosphate complex
PDB Compounds: (B:) ribonuclease pancreatic

SCOPe Domain Sequences for d3dxgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dxgb_ d.5.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

SCOPe Domain Coordinates for d3dxgb_:

Click to download the PDB-style file with coordinates for d3dxgb_.
(The format of our PDB-style files is described here.)

Timeline for d3dxgb_: