SCOPe 2.07: Domain d3dp9a_: 3dp9 A:

Lineage for d3dp9a_ (3dp9 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein automated matches [190142] (20 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [188799] (2 PDB entries)

8. Domain d3dp9a_: 3dp9 A: [174146]
   automated match to d1jysa_
   complexed with big, iod

Details for d3dp9a_

PDB Entry: 3dp9, 2.3 Å

PDB Description: crystal structure of vibrio cholerae 5'-methylthioadenosine/s-adenosyl homocysteine nucleosidase (mtan) complexed with butylthio-dadme- immucillin a

PDB Compounds: (A:) MTA/SAH nucleosidase

SCOPe Domain Sequences for d3dp9a_:

Sequence; same for both SEQRES and ATOM records:

>d3dp9a_ c.56.2.1 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
kigiigamqqevailkdliedvqevnqagctfysgqiqgvdvvllqsgigkvsaalgtal
lisqyapdvvintgsaggfdaslnvgdvvissevrhhdadvtafgyeigqmagqpaafka
deklmtvaeqalaqlpnthavrglictgdafvctaerqqfirqhfpsvvavemeasaiaq
tchqfkvpfvvvraisdvadkesplsfeeflplaaksssamvlkmvell

Timeline for d3dp9a_:

• d3dp9a_ first appeared in SCOPe 2.01
  
• d3dp9a_ appears in SCOPe 2.06
  
• d3dp9a_ appears in the current release, SCOPe 2.08