Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
Protein Neutrophil collagenase (MMP-8) [55532] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55533] (24 PDB entries) |
Domain d3dnga_: 3dng A: [174079] automated match to d1i73a_ complexed with axa, ca, zn |
PDB Entry: 3dng (more details), 2 Å
SCOPe Domain Sequences for d3dnga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dnga_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]} mltpgnpkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadin iafyqrdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahef ghslglahssdpgalmypnyafretsnyslpqddidgiqaiyg
Timeline for d3dnga_: