Lineage for d3dnga_ (3dng A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2570196Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2570846Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2571142Protein Neutrophil collagenase (MMP-8) [55532] (1 species)
  7. 2571143Species Human (Homo sapiens) [TaxId:9606] [55533] (24 PDB entries)
  8. 2571167Domain d3dnga_: 3dng A: [174079]
    automated match to d1i73a_
    complexed with axa, ca, zn

Details for d3dnga_

PDB Entry: 3dng (more details), 2 Å

PDB Description: crystal structure of the complex between mmp-8 and a non-zinc chelating inhibitor
PDB Compounds: (A:) Neutrophil collagenase

SCOPe Domain Sequences for d3dnga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dnga_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]}
mltpgnpkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadin
iafyqrdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahef
ghslglahssdpgalmypnyafretsnyslpqddidgiqaiyg

SCOPe Domain Coordinates for d3dnga_:

Click to download the PDB-style file with coordinates for d3dnga_.
(The format of our PDB-style files is described here.)

Timeline for d3dnga_: