SCOPe 2.07: Domain d3dhhc_: 3dhh C:

Lineage for d3dhhc_ (3dhh C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.12: TmoB-like [110814] (2 families)
   possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies

5. Family d.15.12.0: automated matches [191572] (1 protein)
   not a true family

6. Protein automated matches [190991] (1 species)
   not a true protein

7. Species Pseudomonas mendocina [TaxId:300] [188696] (20 PDB entries)

8. Domain d3dhhc_: 3dhh C: [173945]
   Other proteins in same PDB: d3dhha_, d3dhhe_
   automated match to d1t0rc_
   complexed with 1pe, bml, btb, cl, fe

Details for d3dhhc_

PDB Entry: 3dhh, 1.94 Å

PDB Description: crystal structure of resting state toluene 4-monoxygenase hydroxylase complexed with effector protein

PDB Compounds: (C:) toluene 4-monooxygenase hydroxylase gamma subunit

SCOPe Domain Sequences for d3dhhc_:

Sequence; same for both SEQRES and ATOM records:

>d3dhhc_ d.15.12.0 (C:) automated matches {Pseudomonas mendocina [TaxId: 300]}
safpvhaafekdflvqlvvvdlndsmdqvaekvayhcvnrrvapregvmrvrkhrstelf
prdmtiaesglnptevidvvfee

Timeline for d3dhhc_:

• d3dhhc_ first appeared in SCOPe 2.01
  
• d3dhhc_ appears in SCOPe 2.06
  
• d3dhhc_ appears in the current release, SCOPe 2.08