Lineage for d3dgac_ (3dga C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2578667Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2578668Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2578669Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2579104Protein automated matches [190469] (17 species)
    not a true protein
  7. 2579221Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [188759] (2 PDB entries)
  8. 2579224Domain d3dgac_: 3dga C: [173920]
    Other proteins in same PDB: d3dgaa_, d3dgab_
    automated match to d1j3ic_
    complexed with ndp, rj1, ump

Details for d3dgac_

PDB Entry: 3dga (more details), 2.7 Å

PDB Description: wild-type plasmodium falciparum dihydrofolate reductase-thymidylate synthase (pfdhfr-ts) complexed with rjf01302, nadph, and dump
PDB Compounds: (C:) Bifunctional dihydrofolate reductase-thymidylate synthase

SCOPe Domain Sequences for d3dgac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dgac_ d.117.1.1 (C:) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
deeeddfvyfnfnkekeeknknsihpndfqiynslkykyhpeyqylniiydimmngnkqs
drtgvgvlskfgyimkfdlsqyfpllttkklflrgiieellwfirgetngntllnknvri
weangtrefldnrklfhrevndlgpiygfqwrhfgaeytnmydnyenkgvdqlkniinli
kndptsrrillcawnvkdldqmalppchilcqfyvfdgklscimyqrscdlglgvpfnia
sysifthmiaqvcnlqpaqfihvlgnahvynnhidslkiqlnripypfptlklnpdikni
edftisdftiqnyvhhekismdmaa

SCOPe Domain Coordinates for d3dgac_:

Click to download the PDB-style file with coordinates for d3dgac_.
(The format of our PDB-style files is described here.)

Timeline for d3dgac_: