Lineage for d3df9b_ (3df9 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2495644Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2495645Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2496449Protein automated matches [190142] (20 species)
    not a true protein
  7. 2496479Species Escherichia coli [TaxId:562] [186867] (5 PDB entries)
  8. 2496483Domain d3df9b_: 3df9 B: [173884]
    Other proteins in same PDB: d3df9a2
    automated match to d1nc3a_
    complexed with df9

Details for d3df9b_

PDB Entry: 3df9 (more details), 1.95 Å

PDB Description: Crystal structure of E. coli MTA/SAH nucleosidase in complex with BnT-DADMeImmA
PDB Compounds: (B:) MTA/SAH nucleosidase

SCOPe Domain Sequences for d3df9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3df9b_ c.56.2.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
mkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgigkvaaalgat
lllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeygqlpgcpagfk
addkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaiavemeataiah
vchnfnvpfvvvraisdvadqqshlsfdeflavaakqsslmveslvqklahg

SCOPe Domain Coordinates for d3df9b_:

Click to download the PDB-style file with coordinates for d3df9b_.
(The format of our PDB-style files is described here.)

Timeline for d3df9b_: