Lineage for d3df8a_ (3df8 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1478534Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1479947Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1479948Protein automated matches [190154] (52 species)
    not a true protein
  7. 1480286Species Thermoplasma volcanium [TaxId:50339] [188518] (1 PDB entry)
  8. 1480287Domain d3df8a_: 3df8 A: [173882]
    automated match to d1yyva1
    complexed with act

Details for d3df8a_

PDB Entry: 3df8 (more details), 1.65 Å

PDB Description: The crystal structure of a possible HxlR family transcriptional factor from Thermoplasma volcanium GSS1
PDB Compounds: (A:) possible HxlR family transcriptional factor

SCOPe Domain Sequences for d3df8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3df8a_ a.4.5.0 (A:) automated matches {Thermoplasma volcanium [TaxId: 50339]}
snamlrygdteicidpsesvlhllgkkytmliisvlgngstrqnfndirssipgisstil
srrikdlidsglverrsgqittyaltekgmnvrnslmpllqyisvldrn

SCOPe Domain Coordinates for d3df8a_:

Click to download the PDB-style file with coordinates for d3df8a_.
(The format of our PDB-style files is described here.)

Timeline for d3df8a_: