Lineage for d3daqa_ (3daq A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2443024Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2444581Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2444582Protein automated matches [190115] (91 species)
    not a true protein
  7. 2445205Species Staphylococcus aureus [TaxId:282458] [188514] (1 PDB entry)
  8. 2445206Domain d3daqa_: 3daq A: [173787]
    automated match to d1o5ka_
    complexed with cl, gol

Details for d3daqa_

PDB Entry: 3daq (more details), 1.45 Å

PDB Description: Crystal structure of dihydrodipicolinate synthase from methicillin-resistant Staphylococcus aureus
PDB Compounds: (A:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3daqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3daqa_ c.1.10.0 (A:) automated matches {Staphylococcus aureus [TaxId: 282458]}
thlfegvgvalttpftnnkvnlealkahvnfllennaqaiivngttaesptlttdekeli
lktvidlvdkrvpviagtgtndteksiqasiqakalgadaimlitpyynktnqrglvkhf
eaiadavklpvvlynvpsrtnmtiepetveilsqhpyivalkdatndfeyleevkkridt
nsfalysgnddnvveyyqrggqgvisvianvipkefqalydaqqsgldiqdqfkpigtll
salsvdinpipikaltsylgfgnyelrlplvsledtdtkvlreaydtfkage

SCOPe Domain Coordinates for d3daqa_:

Click to download the PDB-style file with coordinates for d3daqa_.
(The format of our PDB-style files is described here.)

Timeline for d3daqa_: