![]() | Class a: All alpha proteins [46456] (218 folds) |
![]() | Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
![]() | Superfamily a.39.1: EF-hand [47473] (10 families) ![]() Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
![]() | Family a.39.1.8: Penta-EF-hand proteins [63550] (5 proteins) |
![]() | Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [47554] (5 PDB entries) |
![]() | Domain d1df0b_: 1df0 B: [17369] Other proteins in same PDB: d1df0a1, d1df0a2, d1df0a3 |
PDB Entry: 1df0 (more details), 2.6 Å
SCOP Domain Sequences for d1df0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1df0b_ a.39.1.8 (B:) Calpain small (regulatory) subunit (domain VI) {Rat (Rattus norvegicus)} neseeerqfrklfvqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmd sdttgklgfeefkylwnnikkwqgiykrfdtdrsgtigsnelpgafeaagfhlnqhiysm iirrysdetgnmdfdnfisclvrldamfrafrsldkngtgqiqvniqewlqltmys
Timeline for d1df0b_: