![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
![]() | Protein Plastocyanin [49507] (17 species) |
![]() | Species Phormidium laminosum [TaxId:32059] [49518] (8 PDB entries) |
![]() | Domain d3cvdc_: 3cvd C: [173500] automated match to d1bawa_ complexed with cu1, zn |
PDB Entry: 3cvd (more details), 1.5 Å
SCOPe Domain Sequences for d3cvdc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cvdc_ b.6.1.1 (C:) Plastocyanin {Phormidium laminosum [TaxId: 32059]} etftvkmgadsglfqfepanvtvhpgdtvkwvnnklpphnilfddkqvpgaskeladkls hsqlmfspgesyeitfssdfpagtytyycaphrgagmvgkitve
Timeline for d3cvdc_: