Lineage for d3cpcb_ (3cpc B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2589670Protein Vascular endothelial growth factor receptor 2 (kdr) [56160] (1 species)
    PTK group; PDGFR/VEGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2589671Species Human (Homo sapiens) [TaxId:9606] [56161] (25 PDB entries)
  8. 2589689Domain d3cpcb_: 3cpc B: [173390]
    Other proteins in same PDB: d3cpca2
    automated match to d1vr2a_
    complexed with c52

Details for d3cpcb_

PDB Entry: 3cpc (more details), 2.4 Å

PDB Description: crystal structure of the vegfr2 kinase domain in complex with a pyridone inhibitor
PDB Compounds: (B:) Vascular endothelial growth factor receptor 2

SCOPe Domain Sequences for d3cpcb_:

Sequence, based on SEQRES records: (download)

>d3cpcb_ d.144.1.7 (B:) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]}
lpydaskwefprdrlklgkplgrgafgqvieadafgidktatcrtvavkmlkegathseh
ralmselkilihighhlnvvnllgactkpggplmvitefckfgnlstylrskrnefvpyk
vapedlykdfltlehlicysfqvakgmeflasrkcihrdlaarnillseknvvkicdfgl
ardiykdpdyvrkgdarlplkwmapetifdrvytiqsdvwsfgvllweifslgaspypgv
kideefcrrlkegtrmrapdyttpemyqtmldcwhgepsqrptfselvehlgnllq

Sequence, based on observed residues (ATOM records): (download)

>d3cpcb_ d.144.1.7 (B:) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]}
lpydaskwefprdrlklgkplgqvieadafgidktatcrtvavkmlathsehralmselk
ilihighhlnvvnllgactkpggplmvitefckfgnlstylrskrnefvpykdfltlehl
icysfqvakgmeflasrkcihrdlaarnillseknvvkicdfglplkwmapetifdrvyt
iqsdvwsfgvllweifslgaspypgvkideefcrrlkegtrmrapdyttpemyqtmldcw
hgepsqrptfselvehlgnllq

SCOPe Domain Coordinates for d3cpcb_:

Click to download the PDB-style file with coordinates for d3cpcb_.
(The format of our PDB-style files is described here.)

Timeline for d3cpcb_: