Class a: All alpha proteins [46456] (202 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (10 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (21 proteins) Duplication: made with two pairs of EF-hands |
Protein Calcineurin regulatory subunit (B-chain) [47530] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [47532] (3 PDB entries) |
Domain d1auib_: 1aui B: [17325] Other proteins in same PDB: d1auia_ complexed with ca, fe, zn |
PDB Entry: 1aui (more details), 2.1 Å
SCOP Domain Sequences for d1auib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens)} syplemcshfdadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvidifdtd gngevdfkefiegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmvgnnlk dtqlqqivdktiinadkdgdgrisfeefcavvggldihkkmvvdv
Timeline for d1auib_: