SCOPe 2.07: Domain d3ch6b1: 3ch6 B:24-288

Lineage for d3ch6b1 (3ch6 B:24-288)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117424] (29 PDB entries)
   Uniprot P28845

8. Domain d3ch6b1: 3ch6 B:24-288 [173242]
   Other proteins in same PDB: d3ch6b2, d3ch6d2
   automated match to d1xu9a_
   complexed with 311, nap; mutant

Details for d3ch6b1

PDB Entry: 3ch6, 2.35 Å

PDB Description: crystal structure of 11beta-hsd1 double mutant (l262r, f278e) complexed with (3,3-dimethylpiperidin-1-yl)(6-(3-fluoro-4- methylphenyl)pyridin-2-yl)methanone

PDB Compounds: (B:) Corticosteroid 11-beta-dehydrogenase isozyme 1

SCOPe Domain Sequences for d3ch6b1:

Sequence; same for both SEQRES and ATOM records:

>d3ch6b1 c.2.1.2 (B:24-288) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]}
neefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelga
asahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevn
flsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysv
srvnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydssrw
ttllirnpcrkileelystsynmdr

Timeline for d3ch6b1:

• d3ch6b1 first appeared in SCOPe 2.01, called d3ch6b_
  
• d3ch6b1 appears in SCOPe 2.06
  
• d3ch6b1 appears in the current release, SCOPe 2.08