Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [117424] (29 PDB entries) Uniprot P28845 |
Domain d3ch6b1: 3ch6 B:24-288 [173242] Other proteins in same PDB: d3ch6b2, d3ch6d2 automated match to d1xu9a_ complexed with 311, nap; mutant |
PDB Entry: 3ch6 (more details), 2.35 Å
SCOPe Domain Sequences for d3ch6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ch6b1 c.2.1.2 (B:24-288) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} neefrpemlqgkkvivtgaskgigremayhlakmgahvvvtarsketlqkvvshclelga asahyiagtmedmtfaeqfvaqagklmggldmlilnhitntslnlfhddihhvrksmevn flsyvvltvaalpmlkqsngsivvvsslagkvaypmvaaysaskfaldgffssirkeysv srvnvsitlcvlglidtetamkavsgivhmqaapkeecaleiikggalrqeevyydssrw ttllirnpcrkileelystsynmdr
Timeline for d3ch6b1:
View in 3D Domains from other chains: (mouse over for more information) d3ch6a_, d3ch6d1, d3ch6d2, d3ch6e_ |