Lineage for d3ch1e_ (3ch1 E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2745638Protein beta2-microglobulin [88600] (7 species)
  7. 2746421Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries)
    Uniprot P01887
  8. 2746525Domain d3ch1e_: 3ch1 E: [173238]
    Other proteins in same PDB: d3ch1a1, d3ch1a2, d3ch1d1, d3ch1d2, d3ch1g1, d3ch1g2, d3ch1j1, d3ch1j2
    automated match to d1biib_
    complexed with gol, so4

Details for d3ch1e_

PDB Entry: 3ch1 (more details), 2.3 Å

PDB Description: Crystal structure of H-2Db in complex with chimeric gp100
PDB Compounds: (E:) Beta-2-microglobulin

SCOPe Domain Sequences for d3ch1e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ch1e_ b.1.1.2 (E:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d3ch1e_:

Click to download the PDB-style file with coordinates for d3ch1e_.
(The format of our PDB-style files is described here.)

Timeline for d3ch1e_: