Lineage for d3cglc_ (3cgl C:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1407410Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1407411Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1407412Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1407645Protein automated matches [190406] (14 species)
    not a true protein
  7. 1407795Species Discosoma striata [188537] (1 PDB entry)
  8. 1407798Domain d3cglc_: 3cgl C: [173226]
    automated match to d1mova_
    complexed with na

Details for d3cglc_

PDB Entry: 3cgl (more details), 2.09 Å

PDB Description: crystal structure and raman studies of dsfp483, a cyan fluorescent protein from discosoma striata
PDB Compounds: (C:) GFP-like fluorescent chromoprotein dsFP483

SCOPe Domain Sequences for d3cglc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cglc_ d.22.1.1 (C:) automated matches {Discosoma striata}
svikeemlidlhlegtfnghyfeikgkgkgqpnegtntvtlevtkggplpfgwhilcpqf
qygnkafvhhpdnihdylklsfpegytwersmhfedgglccitndisltgncfyydikft
glnfppngpvvqkkttgwepsterlyprdgvligdihhaltveggghyacdiktvyrakk
aalkmpgyhyvdtklviwnndkefmkveeheiavarhhpfyep

SCOPe Domain Coordinates for d3cglc_:

Click to download the PDB-style file with coordinates for d3cglc_.
(The format of our PDB-style files is described here.)

Timeline for d3cglc_: