Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein automated matches [190329] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187151] (9 PDB entries) |
Domain d3cckb_: 3cck B: [173140] automated match to d1fm5a_ complexed with cl |
PDB Entry: 3cck (more details), 1.8 Å
SCOPe Domain Sequences for d3cckb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cckb_ d.169.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vsscsedwvgyqrkcyfistvkrswtsaqnacsehgatlavidsekdmnflkryagreeh wvglkkepghpwkwsngkefnnwfnvtgsdkcvflkntevssmeceknlywicnkpyk
Timeline for d3cckb_: