![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
![]() | Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() automatically mapped to Pfam PF00124 |
![]() | Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
![]() | Protein automated matches [190224] (17 species) not a true protein |
![]() | Species Thermosynechococcus elongatus [TaxId:32046] [188744] (2 PDB entries) |
![]() | Domain d3bz1d_: 3bz1 D: [172943] Other proteins in same PDB: d3bz1b_, d3bz1c_, d3bz1e_, d3bz1f_, d3bz1h_, d3bz1i_, d3bz1j_, d3bz1k_, d3bz1l_, d3bz1m_, d3bz1o_, d3bz1t_, d3bz1u_, d3bz1v_, d3bz1x_, d3bz1z_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd complexed with bcr, bct, ca, cl, cla, dgd, fe2, hem, lhg, lmg, lmt, oec, pho, pl9, sqd |
PDB Entry: 3bz1 (more details), 2.9 Å
SCOPe Domain Sequences for d3bz1d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bz1d_ f.26.1.1 (D:) automated matches {Thermosynechococcus elongatus [TaxId: 32046]} gwfdilddwlkrdrfvfvgwsgillfpcaylalggwltgttfvtswythglassylegcn fltvavstpansmghsllllwgpeaqgdftrwcqlgglwtfialhgafgligfmlrqfei arlvgvrpynaiafsapiavfvsvfliyplgqsswffapsfgvaaifrfllffqgfhnwt lnpfhmmgvagvlggallcaihgatventlfqdgegastfrafnptqaeetysmvtanrf wsqifgiafsnkrwlhffmlfvpvtglwmsaigvvglalnlrsydfisqeiraaedpefe tfytknlllnegirawmapqdqphenfvfpeevlprgnal
Timeline for d3bz1d_: