Lineage for d1ahra_ (1ahr A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1489461Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1489462Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1489858Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1489910Protein Calmodulin [47516] (12 species)
  7. 1489941Species Chicken (Gallus gallus) [TaxId:9031] [47520] (9 PDB entries)
    mutant with a two residue deletion in the central helix
  8. 1489945Domain d1ahra_: 1ahr A: [17287]
    complexed with ca; mutant

Details for d1ahra_

PDB Entry: 1ahr (more details), 1.8 Å

PDB Description: calmodulin mutant with a two residue deletion in the central helix
PDB Compounds: (A:) calmodulin

SCOPe Domain Sequences for d1ahra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahra_ a.39.1.5 (A:) Calmodulin {Chicken (Gallus gallus) [TaxId: 9031]}
adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
gtidfpefltmmarkmkdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeevd
emireadidgdgqvnyeefvtmmtsk

SCOPe Domain Coordinates for d1ahra_:

Click to download the PDB-style file with coordinates for d1ahra_.
(The format of our PDB-style files is described here.)

Timeline for d1ahra_: