SCOP 1.67: Domain d3cln__: 3cln -

Lineage for d3cln__ (3cln -)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (10 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (21 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calmodulin [47516] (9 species)

7. Species Rat (Rattus rattus) [TaxId:10117] [47519] (3 PDB entries)

8. Domain d3cln__: 3cln - [17286]
   complexed with ca

Details for d3cln__

PDB Entry: 3cln, 2.2 Å

PDB Description: structure of calmodulin refined at 2.2 angstroms resolution

SCOP Domain Sequences for d3cln__:

Sequence; same for both SEQRES and ATOM records:

>d3cln__ a.39.1.5 (-) Calmodulin {Rat (Rattus rattus)}
teeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgngtid
fpefltmmarkmkdtdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdem
ireanidgdgqvnyeefvqmmta

Timeline for d3cln__:

• d3cln__ first appeared (with stable ids) in SCOP 1.55
  
• d3cln__ appears in SCOP 1.65
  
• d3cln__ appears in SCOP 1.69
  
• d3cln__ appears in the current release, SCOPe 2.08, called d3clna_