SCOPe 2.04: Domain d3bpua_: 3bpu A:

Lineage for d3bpua_ (3bpu A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187333] (75 PDB entries)

8. Domain d3bpua_: 3bpu A: [172775]
   automated match to d1ujva_
   complexed with zn; mutant

Details for d3bpua_

PDB Entry: 3bpu, 1.6 Å

PDB Description: crystal structure of the 3rd pdz domain of human membrane associated guanylate kinase, c677s and c709s double mutant

PDB Compounds: (A:) Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1

SCOPe Domain Sequences for d3bpua_:

Sequence, based on SEQRES records:

>d3bpua_ b.36.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smelitvhivkgpmgfgftiadspggggqrvkqivdsprsrglkegdlivevnkknvqal
thnqvvdmlvespkgsevtllvqrqtrl

Sequence, based on observed residues (ATOM records):

>d3bpua_ b.36.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smelitvhivkgpmgfgftiadspggggqrvkqivdrsrglkegdlivevnkknvqalth
nqvvdmlvespkgsevtllvqrqtrl

Timeline for d3bpua_:

• d3bpua_ first appeared in SCOPe 2.01
  
• d3bpua_ appears in SCOPe 2.03
  
• d3bpua_ appears in SCOPe 2.05
  
• d3bpua_ appears in the current release, SCOPe 2.08, called d3bpua1