![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
![]() | Protein automated matches [190036] (58 species) not a true protein |
![]() | Species Mycobacterium smegmatis [TaxId:246196] [188322] (14 PDB entries) |
![]() | Domain d3bkni_: 3bkn I: [172689] automated match to d1jgca_ complexed with epe, hem, mg, zn |
PDB Entry: 3bkn (more details), 2.72 Å
SCOPe Domain Sequences for d3bkni_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bkni_ a.25.1.0 (I:) automated matches {Mycobacterium smegmatis [TaxId: 246196]} mqgdpdvlkllneqltseltainqyflhskmqdnwgftelaehtraesfeemrhaetitd rillldglpnyqrlfslrvgqtlreqfeadlaieyevlerlkpgivlcrekqdatsarll eqiladeethidyletqlqlmdklgdalyaaqcvsrppgsa
Timeline for d3bkni_: